Answer:
b metal denting
Explanation:
Answer:
Choice b) Metal denting.
Explanation:
What's the difference between chemical and physical changes? In a chemical change, new substances are created. However, the types of substances stay the same in a physical change.
a)When silver tarnishes, it reacts with a substance that contains sulfur (e.g., [tex]\rm SO_3[/tex]) to produce silver sulfide, which is a substance different from the other two.
Before the change:
Silver;A substance that contains sulfur.After the change:
Silver sulfide.A new substance is created in this change. As a result, this change is chemical.
b)When metal is dented, atoms in the metal slide past each other. The shape of the metal might change, however the substance will still be the same the metal.
Before the change:
This particular metal.After the change:
This particular metal.No substance is created. As a result, this change is physical.
c)When iron rusts in the air, it reacts with oxygen to produce oxides of iron.
Before the change:
Iron;Oxygen.After the change:
Oxides of iron.Oxides of iron are created. As a result, this change is chemical.
d)When gasoline burns in the air, it reacts with oxygen to produce water and carbon dioxide (or carbon monoxide, or both.)
Before the change:
Gasoline;Oxygen.After the change:
Water;Carbon dioxide, carbon monoxide, or both.Water and carbon dioxide/monoxide are created. As a result, this change is chemical.
Why is it important to compensate for pressure and temperature when an orifice is used to measure gas flow
Explanation:
Orifice meters require to compensate for pressure and temperature when one uses these meters to measure the steam or the gas flow in the pipes with the variable operating pressure as well as temperature conditions.
Normally chemists do not have online density measurement tool and thus to avoid complications, the chemists consider density as constant parameter.
In the steam or the gas flow measurement, density of steam or gas changes as the pressure and the temperature change. This significant change in the density can affect accuracy of measured flow rate if the change is uncompensated and thus, this has to be fixed in order to avoid errors. Therefore, it is important to compensate for the pressure and the temperature when orifice is used to measure the steam or the gas flow.
Enter your answer in the provided box. Remember to enter your answer to the correct number of significant figures. For the reaction: A(g) + B(g) → AB(g) the rate is 0.23 mol/L·s, when [A]0 = [B]0 = 1.0 mol/L. If the reaction is first order in B and second order in A, what is the rate when [A]0 = 2.0 mol/L and [B]0 = 4.6 mol/L?
Answer : The rate law is 4.232 mol/L.s
Explanation :
First we have to calculate the value of rate constant.
According to the question, the expression for rate law will be:
[tex]Rate=k[A]^2[B][/tex]
where,
k = rate constant
As we are given :
Rate law = 0.23 mol/L.s
Initial concentration of A = 1.0 mol/L
Initial concentration of B = 1.0 mol/L
Now put all the given values in the above rate law expression, we get:
[tex]0.23mol/L.s=k\times (1.0mol/L)^2\times (1.0mol/L)[/tex]
[tex]k=0.23M^{-2}s^{-1}[/tex]
Now we have to calculate the rate law when initial concentration of A and B is 2.0 mol/L and 4.6 mol//L respectively.
The expression for rate law will be:
[tex]Rate=k[A]^2[B][/tex]
where,
k = rate constant = [tex]0.23M^{-2}s^{-1}[/tex]
Rate law = ?
Initial concentration of A = 2.0 mol/L
Initial concentration of B = 4.6 mol/L
Now put all the given values in the above rate law expression, we get:
[tex]Rate=(0.23M^{-2}s^{-1})\times (2.0mol/L)^2\times (4.6mol/L)[/tex]
[tex]Rate=4.232mol/L.s[/tex]
Therefore, the rate law is 4.232 mol/L.s
The study of chemicals and bonds is called chemistry. When the amount of reactant and product are equal then is said to be an equilibrium state.
The correct answer is 4.232.
What is equilibrium constant?The equilibrium constant of a chemical reaction is the value of its reaction quotient at chemical equilibrium.A state approached by a dynamic chemical system after sufficient time has elapsed at which its composition has no measurable tendency towards further change.According to the question, the expression for rate law will be:
[tex]Rate =k[A]^2[B][/tex]
where,
k = rate constantThe data is given as follows:-
Rate law = 0.23 mol/L.sInitial concentration of A = 1.0 mol/LInitial concentration of B = 1.0 mol/LPlace all the values in the equation and solve it
[tex]0.23= k*1^2*1\\\\k= 0.23[/tex]
Now we have to calculate the rate law when the initial concentration of A and B is 2.0 mol/L and 4.6 mol//L respectively.
The expression for rate law will be:
[tex]Rate =k[A]^2[B][/tex]
where,
k = rate constant = 0.23Initial concentration of A = 2.0 mol/LInitial concentration of B = 4.6 mol/L[tex]Rate = 0.23*2^2*4.6[/tex]
Hence, the rate will be 4.232.
For more information about the rate of the equation, refer to the link:-
https://brainly.com/question/16759172
Conversion of flow quantities by the continuity equation Water flows through a 3-inch, schedule 40 steel pipe (inside diameter- 3.068 inches) with an average velocity of 4 ft/s. Compute: (a) mass flow rate in lb/h, (b) volumetric flow rate in ft /h, and (c) mass velocity (mass flux) in lb/h-ft.
Answer:
a) m = 2398256.64 Ib/hr
b) Q = 38433.6 ft^3/hr
c) J = = 898560 lb/h-ft2
Explanation:
a) To get the mass flow rate in lb/h we are going to use this formula:
m = ρνA
note: we have to change some units to reach to the final units
when m is the mass flow rate which we need to calculate
ρ is the density of water in lb/ft3 = 62.4 lbs/ft3 it is a constant numbers you can get it from anywhere
ν is the velocity of the water = 4 ft/s we need to change it to ft/h unit so
when 1 ft/s = 3600 ft/hr (note : 3600 is a result of converting hr to sec 60min*60sec)
so the velocity of the water = 4 ft/s * 3600 ft/hr= 14400 ft/hr
now , we need to get the area of the pipe in feet also when:
A = π*diameter * length
diameter = 3.068 inches
when 1 inch = 0.0833333333 feet so,
diameter in feet = 3.068 * 0.0833333333 =.300 0.2557ft
and length = 40 * 0.0833333333 = 3.333 ft
so the area of the pipe in feet^2 = 3.14*0.255*3.33 =2.669 ft^2
by substitution in the mass flow rate:
m = 62.4 lbs/ft3 * 14400 ft/hr *2.669 ft^2 = 2398256.64 Ib/hr
b) now to calculate volumetric flow rate in ft /h we are going to use this formula:
Q = AV
when Q is the volume flow rate
A is the cross-sectional area filled by water =2.669 ft^2
V is the average velocity of the water = 14400 ft/hr
so , by substitution:
Q = 2.669 ft^2* 14400 ft/hr= 38433.6 ft^3/hr
C) To calculate mass velocity (mass flux) in lb/h-ft we are going to use this formula:
J = m / A
when J is the mass flux
and m is the mass flow rate which we calculated above = 2398256.64 Ib/hr
and A is the cross section area of the pipe which we calculated above and = 2.669 ft^2
so, by substitution:
J = 2398256.64 Ib/hr / 2.669 ft^2
= 898560 lb/h-ft2
At 14,000 ft elevation the air pressure drops to 0.59 atm. Assume you take a 1L sample of air at this altitude and compare it to 1 L of air taken at sea level. How much less O2 (in g) is available in 1 L of air at 14,000 ft (assume temperature of 298 K and that relative gas percentages are constant in both locations).
Answer:
There are 0.1125 g of O₂ less in 1 L of air at 14,000 ft than in 1 L of air at sea level.
Explanation:
To solve this problem we use the ideal gas law:
PV=nRT
Where P is pressure (in atm), V is volume (in L), n is the number of moles, T is temperature (in K), and R is a constant (0.082 atm·L·mol⁻¹·K⁻¹)
Now we calculate the number of moles of air in 1 L at sea level (this means with P=1atm):
1 atm * 1 L = n₁ * 0.082 atm·L·mol⁻¹·K⁻¹ * 298 K
n₁=0.04092 moles
Now we calculate n₂, the number of moles of air in L at an 14,000 ft elevation, this means with P = 0.59 atm:
0.59 atm * 1 L = n₂ * 0.082 atm·L·mol⁻¹·K⁻¹ * 298 K
n₂=0.02414 moles
In order to calculate the difference in O₂, we substract n₂ from n₁:
0.04092 mol - 0.02414 mol = 0.01678 mol
Keep in mind that these 0.01678 moles are of air, which means that we have to look up in literature the content of O₂ in air (20.95%), and then use the molecular weight to calculate the grams of O₂ in 20.95% of 0.01678 moles:
[tex]0.01678mol*\frac{20.95}{100} *32\frac{g}{mol} =0.1125 gO_{2}[/tex]
A weak acid. What is the pH of a 0.1 M solution of acetic acid (pKa = 4.75)?
(Hint: Let x be the concentration of H+ ions released from acetic acid when it dissociates. The solutions to a quadratic equation of the form ax^2 + bx + c = 0 are x = (-b +- squareroot (b^2- 4ac)/2a.
Answer:
pH of acetic acid solution is 2.88
Explanation:
[tex]pK_{a}=4.75[/tex]
or, [tex]-log(K_{a})=4.75[/tex]
or, [tex]K_{a}=10^{-4.75}=1.78\times 10^{-5}[/tex]
We have to construct an ICE table to determine concentration of [tex]H^{+}[/tex] and corresponding pH. Initial concentration of acetic acid is 0.1 M.
[tex]CH_{3}COOH\rightleftharpoons CH_{3}COO^{-}+H^{+}[/tex]
I(M): 0.1 0 0
C(M): -x +x +x
E(M): 0.1-x x x
So, [tex]\frac{[CH_{3}COO^{-}][H^{+}]}{[CH_{3}COOH]}=K_{a}[/tex]
or, [tex]\frac{x^{2}}{0.1-x}=1.78\times 10^{-5}[/tex]
or, [tex]x^{2}+(1.78\times 10^{-5}\times x)-(1.78\times 10^{-6})=0[/tex]
So, [tex]x=\frac{-(1.78\times 10^{-5})+\sqrt{(1.78\times 10^{-5})^{2}+(4\times 1\times 1.78\times 10^{-6})}}{2\times 1}[/tex](M)
so, [tex]x=1.33\times 10^{-3}M[/tex]
Hence [tex]pH=-log[H^{+}]=-log(1.33\times 10^{-3})=2.88[/tex]
A certain insulation has a thermal conductivity of 0.2 W/m °C What thickness is necessary to effect a temperature drop of 400°C for a heat flux of 200 W/m2?
Answer:
It is necessary 1 meter of thickness.
Explanation:
You need to know the equation (P/A)=(k*T)/(L), where P/A is the heat flux, k is the thermal conductivity, T the temperature drop, and L the unknown thickness. So if rearrange the variables you will have that L = (k*T)/(P/A), and substituting the terms L = (0.2*400)/(200) = 1 meter
Final answer:
The necessary thickness of insulation to achieve a temperature drop of 400°C with a heat flux of 200 W/m^2, given a thermal conductivity of 0.2 W/m°C, is 0.4 meters.
Explanation:
The necessary thickness of insulation for a specific temperature drop and heat flux. By using the equation of thermal conduction Q = (kAΔT)/d, where Q is the heat flux, k is the thermal conductivity, A is the area, ΔT is the temperature difference, and d is the thickness, we can solve for the thickness d.
To start, we know that k (thermal conductivity) is 0.2 W/m°C, the temperature drop ΔT is 400°C, and the heat flux Q is 200 W/m^2. Plugging these values into the equation gives us d = (kAΔT)/Q. Since the area A is not specified, it will cancel out in this case, allowing us to solve for d directly. Rearranging the equation yields d = (kΔT)/Q, which equals (0.2 W/m°C * 400°C)/200 W/m^2, resulting in d = 0.4 m. Therefore, the thickness required for this insulation is 0.4 meters.
2 Which of the substances listed below are:
a metallic elements?
b non-metallic elements?
C compounds?
d mixtures?
Silicon, sea water, calcium, argon, water, air, carbon
monoxide, iron, sodium chloride, diamond, brass,
copper, dilute sulphuric acid, sulphur, oil, nitrogen,
ammonia.
^Put these where they belong.
Answer:
See explanation
Explanation:
Sea water = a mixture of different substances in water. If the water evaporates, some of those substances remain as salts. It's not a compound because it's a mixture of compounds and substances. An example of a compound is water ( because it has hydrogen atoms and an oxygen atom)
Calcium = Calcium is found on the periodic table so it cannot be a compound or mixture. It's a metallic element because we can find it on the left side of the periodic table, in group 2. It's an alkaline earth metal, what makes that calcium is a reactive metal.
Argon = Argon is found on the periodic table, so it can't be a mixture or compound. It is a non-metallic element. We can find it in group 18 on the periodic table. Argon is a noble gas, so non-metallic.
Water = a compound because its only made of 2 atoms : oxygen and hydrogen. Reasons why water is a compound and not a mixture are:
- The ormation of a compound is a chemical change which is followed by absorption of energy or evolution of energy, in case of water, electricity is required.
- Mixtures can be separated by physical separation techniques ,Water can not be separated into it its elements by physical separation techniques. But by the absorption of chemical energy.
Air = Mixture because it can be separated into different atoms, molecules,.. like oxygen, nitrogen etc. by the physical separation techniques (fractional distillation).
Carbon Monoxide = Carbon Monoxide is not found on the periodic table so it cannot be an element. It's made of 2 elements, this means caron monoxide is a compound. It's not a mixture since the elements cannot be separated by physical separating techniques.
Iron = Iron is found on the periodic table so it cannot be a compound or mixture. It's a metallic element because:
-High melting point
- Some metals form a dull oxide layer, this explains the shiny luster surface
- Electrical conductivity and thermal conductivity
Sodium chloride = NaCl cannot be found on the periodic table, so it isn't an element. It's a compound because it only has 2 atoms (elements). Those elements cannot be seperated by physical separating techniques, but would require electricity. So it's a compound.
Diamond = is a solid form of the element Carbon. It's an allotrope of carbon. They have the same physical state but in distinct form. Technically diamond is a non-metallic element. Since it's seen as carbon.
Brass = Brass is a mixture of the elements of copper and zinc. Those elements can be separated by physical techniques.
Copper = Copper is found on the periodic table so it cannot be a compound or mixture. It's a metallic element because:
-High melting point
- Some metals form a dull oxide layer, this explains the shiny luster surface
- Electrical conductivity and thermal conductivity
Dilute sulphuric acid = This is a mixture. Sulphuric acid is a compound but to dilute it's added in water, what is another compound. So it's a mixture of different compounds.
Sulphur = Can be found in the periodic table so it cannot be a mixture or compound. It's part of the metalloids, therefore, it can be concluded that sulfur is a non-metal. It belongs to the oxygen family.
Oil = Oil is a mixture of hydrocarbon compounds which varies in lengths.
Nitrogen = Nitrogen is found on the periodic table, so it can't be a mixture or compound. It can be found as a gas so it is a non-metallic element.
Ammonia = a compound of nitrogen and hydrogen with the formula NH3. Those elements cannot be separated with physical separating techniques.
One molecule of the spherically shaped, oxygen‑carrying protein in red blood cells, hemoglobin, has a diameter of 5.5 nm . What is this diameter in meters?
Answer:
[tex]5.5*10x^{-9}m[/tex]
Explanation:
As you have the diameter of the sphere in nanometers (nm), you need to use de conversion factor to find the diameter in meters (m):
First you should put the quantity that you want to convert with its respective units:
[tex]Diameter=5.5nm[/tex]
Then you put the conversion factor, always you should put the same unit that you want to convert in the denominator:
Diameter = [tex]5.5nm*\frac{1*10^{-9}m}{1nm}[/tex]
And finally, you should multiply and/or divide the quantities:
Diameter = [tex]5.5*10^{-9}m[/tex]
A sample of helium gas has a volume of 1.50 L at 159 K and 5.00 atm. When the gas is compressed to 0.200 L at 50.0 atm, the temperature increases markedly. What is the final temperature? Enter your answer in the provided box. K
Answer:
ghdtgfgrdvreeeegrwwggegteefewqrwefrwerrftrtdsfgyuytfgererdf
Explanation:
The given data is as follows.
[tex]V_{1}[/tex] = 1.50 L, [tex]T_{1}[/tex] = 159 K,
[tex]P_{1}[/tex] = 5.00 atm, [tex]V_{2}[/tex] = 0.2 L,
[tex]T_{2}[/tex] = ?, [tex]P_{2}[/tex] = 50.0 atm
And, according to ideal gas equation,
[tex]\frac{P_{1}V_{1}}{T_{1}} = \frac{P_{2}V_{2}}{T_{2}}[/tex]
Hence, putting the given values into the above formula to calculate the value of final temperature as follows.
[tex]\frac{5.0 atm \times 1.50 L}{159 K} = \frac{5 atm \times 0.2 L}{T_{2}}[/tex]
[tex]T_{2}[/tex] = 21.27 K
Thus, we can conclude that the final temperature is 21.27 K .
The density of air under ordinary conditions at 25°C is 1.19 g/L. How many kilograms of air are in a room that measures 10.0 ft × 11.0 ft and has an 10.0 ft ceiling? 1 in = 2.54 cm (exactly); 1 L = 103 cm3.
Answer: The mass of air present in the room is 37.068 kg
Explanation : Given,
Length of the room = 10.0 ft
Breadth of the room = 11.0 ft
Height of the room = 10.0 ft
To calculate the volume of the room by using the formula of volume of cuboid, we use the equation:
[tex]V=lbh[/tex]
where,
V = volume of the room
l = length of the room
b = breadth of the room
h = height of of the room
Putting values in above equation, we get:
[tex]V=10.0ft\times 11.0ft\times 10.0ft=1100ft^3=31148.53L[/tex]
Conversion used : [tex]1ft^3=28.3168L[/tex]
Now we have to calculate the mass of air in the room.
[tex]Density=\frac{Mass}{Volume}[/tex]
[tex]1.19g/L=\frac{Mass}{31148.53L}[/tex]
[tex]Mass=37066.7507g=37.068kg[/tex]
Conversion used : (1 kg = 1000 g)
Therefore, the mass of air present in the room is 37.068 kg
Answer: There are 37 kg of air in the room.
Explanation:
To calculate the volume of cuboid (room), we use the equation:
[tex]V=lbh[/tex]
where,
V = volume of cuboid
l = length of room = 11 ft
b = breadth of room = 10 ft
h = height of room= 10 ft
Putting values in above equation, we get:
[tex]V=10\times 11\times 10=1100ft^3=1100\times 28.3L=31130L[/tex] (Conversion factor: [tex]1ft^3=28.3L[/tex]
To calculate mass of a substance, we use the equation:
[tex]\text{Density of substance}=\frac{\text{Mass of substance}}{\text{Volume of substance}}[/tex]
We are given:
Density of air = 1.19 g/L
Volume of air = volume of room = 31130 L
Putting values in above equation, we get:
[tex]1.19g/L=\frac{\text{Mass of air}}{31130L}\\\\\text{Mass of air}=37000g=37.0kg[/tex] (1kg=1000g)
Hence, the mass of air is 37 kg.
My professor gave me two questions to solve using the Van Der Waals Equation. She told us to solve for P and the second one we have to solve for b
She wants an explanation how we got our answers. What confusing is the fact that she wants the answers in units but she never gave us any numbers to plot for the equations unless she wants us to use Si units. She did however say P=atmosphere, b=litters, and T=kelvin
Van der waals equation
(P+n^2a/V^2)(V-nb)=nRT. solve for P
T=kelvin
P=atmosphere
b=litters
profesor wants units, so im guessing she wants us to use Si units
Answer:
P=atm
[tex]b=\frac{L}{mol}[/tex]
Explanation:
The problem give you the Van Der Waals equation:
[tex](P+\frac{n^{2}a}{V^{2}})(V-nb)=nRT[/tex]
First we are going to solve for P:
[tex](P+\frac{n^{2}a}{V^{2}})=\frac{nRT}{(V-nb)}[/tex]
[tex]P=\frac{nRT}{(V-nb)}-\frac{n^{2}a}{v^{2}}[/tex]
Then you should know all the units of each term of the equation, that is:
[tex]P=atm[/tex]
[tex]n=mol[/tex]
[tex]R=\frac{L.atm}{mol.K}[/tex]
[tex]a=atm\frac{L^{2}}{mol^{2}}[/tex]
[tex]b=\frac{L}{mol}[/tex]
[tex]T=K[/tex]
[tex]V=L[/tex]
where atm=atmosphere, L=litters, K=kelvin
Now, you should replace the units in the equation for each value:
[tex]P=\frac{(mol)(\frac{L.atm}{mol.K})(K)}{L-(mol)(\frac{L}{mol})}-\frac{(mol^{2})(\frac{atm.L^{2}}{mol^{2}})}{L^{2}}[/tex]
Then you should multiply and eliminate the same units which they are dividing each other (Please see the photo below), so you have:
[tex]P=\frac{L.atm}{L-L}-atm[/tex]
Then operate the fraction subtraction:
P=[tex]P=\frac{L.atm-L.atm}{L}[/tex]
[tex]P=\frac{L.atm}{L}[/tex]
And finally you can find the answer:
P=atm
Now solving for b:
[tex](P+\frac{n^{2}a}{V^{2}})(V-nb)=nRT[/tex]
[tex](V-nb)=\frac{nRT}{(P+\frac{n^{2}a}{V^{2}})}[/tex]
[tex]nb=V-\frac{nRT}{(P+\frac{n^{2}a}{V^{2}})}[/tex]
[tex]b=\frac{V-\frac{nRT}{(P+\frac{n^{2}a}{V^{2}})}}{n}[/tex]
Replacing units:
[tex]b=\frac{L-\frac{(mol).(\frac{L.atm}{mol.K}).K}{(atm+\frac{mol^{2}.\frac{atm.L^{2}}{mol^{2}}}{L^{2}})}}{mol}[/tex]
Multiplying and dividing units,(please see the second photo below), we have:
[tex]b=\frac{L-\frac{L.atm}{atm}}{mol}[/tex]
[tex]b=\frac{L-L}{mol}[/tex]
[tex]b=\frac{L}{mol}[/tex]
Write chemical formulas for compounds containing each of the following. One nitrogen atom for every three chlorine atoms.
Answer:
NCL3
Explanation:
NCL3
- nitrogen trichloride.
The chemical formula for a compound containing one nitrogen atom for every three chlorine atoms is NCl₃.
The chemical formula NCl₃ represents a compound consisting of one nitrogen atom and three chlorine atoms. In this formula, "N" represents nitrogen, and "Cl" represents chlorine. The subscript "3" indicates that there are three chlorine atoms bonded to each nitrogen atom in the compound.
This arrangement reflects the stoichiometry of the compound, specifying the relative ratios of the elements. Chemical formulas provide a concise way to describe the composition of substances, allowing scientists to understand the types and quantities of atoms present in a compound.
NCl₃, nitrogen trichloride, is a covalent compound with notable chemical properties, and its formula encapsulates the balanced proportion of nitrogen and chlorine within its molecular structure.
To know more about nitrogen atom here
https://brainly.com/question/2396742
#SPJ3
Air in an internal combustion engine is at 440°F and 150 psia, with a volume of 10 in3 What is the mass of air (in lbm)?
Answer: The mass of air is 0.00260 lbs.
Explanation:
To calculate the number of moles, we use the equation given by ideal gas equation:
PV = nRT
Or,
[tex]PV=\frac{m}{M}RT[/tex]
where,
P = pressure of the gas = 150 psia = 10.2 atm (Conversion factor: 1 psia = 0.068 atm)
V = Volume of gas = [tex]10in^3=0.164L[/tex] (Conversion factor: [tex]1in^3=0.0164L[/tex] )
m = mass of air = ?
M = Average molar mass of air = 28.97 g/mol
R = Gas constant = [tex]0.0820\text{ L atm }mol^{-1}K^{-1}[/tex]
T = temperature of the gas = [tex]440^oF=499.817K[/tex] (Conversion factor: [tex](T(K)-273.15)=(T(^oF)-32)\times \frac{5}{9}[/tex] )
Putting values in above equation, we get:
[tex]10.2atm\times 0.164L=\frac{m}{28.97g/mol}\times 0.0820\text{ L atm }mol^{-1}K^{-1}\times 499.817K\\\\m=1.18g[/tex]
Converting this mass into lbs, we use the conversion factor:
1 lbs = 454 g
So, [tex]1.18g\times \frac{1lbs}{454g}=0.00260lbs[/tex]
Hence, the mass of air is 0.00260 lbs.
For the following reaction, calculate how many grams of each product are formed when 4.05 g of water is used.
2 H20 -----> 2 H2 + O2
Answer: The mass of hydrogen gas and nitrogen gas produced is 0.45 g and 3.15 g respectively.
Explanation:
To calculate the number of moles, we use the equation:
[tex]\text{Number of moles}=\frac{\text{Given mass}}{\text{Molar mass}}[/tex] .....(1)
Given mass of water = 4.05 g
Molar mass of water = 18 g/mol
Putting values in equation 1, we get:
[tex]\text{Moles of water}=\frac{4.05g}{18g/mol}=0.225mol[/tex]
For the given chemical reaction:
[tex]2H_2O\rightarrow 2H_2+O_2[/tex]
For hydrogen:By Stoichiometry of the reaction:
2 moles of water is producing 2 moles of hydrogen gas
So, 0.225 moles of water will produce = [tex]\frac{2}{2}\times 0.225=0.225mol[/tex] of hydrogen gas.
Now, calculating the mass of hydrogen gas by using equation 1, we get:
Moles of hydrogen gas = 0.225 mol
Molar mass of hydrogen gas = 2 g/mol
Putting values in equation 1, we get:
[tex]0.225mol=\frac{\text{Mass of hydrogen gas}}{2g/mol}\\\\\text{Mass of hydrogen gas}=0.45g[/tex]
For nitrogen:By Stoichiometry of the reaction:
2 moles of water is producing 1 mole of nitrogen gas
So, 0.225 moles of water will produce = [tex]\frac{1}{2}\times 0.225=0.1125mol[/tex] of nitrogen gas.
Now, calculating the mass of nitrogen gas by using equation 1, we get:
Moles of nitrogen gas = 0.1125 mol
Molar mass of nitrogen gas = 28 g/mol
Putting values in equation 1, we get:
[tex]0.1125mol=\frac{\text{Mass of nitrogen gas}}{28g/mol}\\\\\text{Mass of nitrogen gas}=3.15g[/tex]
Hence, the mass of hydrogen gas and nitrogen gas produced is 0.45 g and 3.15 g respectively.
Compute the following:
a. 0.034 x 4.13
b. (1.6 x 10-8 )/(7.25 x 10-8 )
c. 0.034 x 4.13
5) (1 pt) The density of titanium is 4.54 g/ml. What is the volume in liters of 2.63 kg of titanium?
3) (1 pts) How many milliseconds are there in 2.25 hours?
Answer:
a. 0.14042
b. 0.221
c. equal to a.
5) 0.579 L
3) 8.1e6 ms
Explanation:
Hello,
In the attached photo you'll find the numerical procedure to get the results.
Best regards.
Which of the following describes what takes place
whensolutions of Pb(NO3)2 and
NH4Clare mixed? Detail the manner in which the
application of thesolubility rules reveal this answer.
A. Pb(NO3)2(aq)
+2NH4Cl(aq)-->NH4NO3(aq)
+PbCl2(s)
B. Pb2++2Cl- --> PbCl2(s)
C. Pb2+(aq) +
2NO3-(aq)+2NH+4(aq)
+2Cl-(aq)-->2NH+4(aq)
+2NO3-(aq) + PbCl2(s)
D. NH+4(aq) +
NO3-(aq)-->2NH4NO32NH4NO3(s)
E. No reaction occurs when the solutions aremixed.
Answer: The correct answer is Option B.
Explanation:
The chemical equation for the reaction of lead (II) nitrate and ammonium chloride follows:
[tex]Pb(NO_3)_2(aq.)+2NH_4Cl(aq.)\rightarrow PbCl_2(s)+2NH_4NO_3(aq.)[/tex]
Ionic form of the above equation follows:
[tex]Pb^{2+}(aq.)+2NO_3^-(aq.)+2NH_4^+(aq.)+Cl^-(aq.)\rightarrow PbCl_2(s)+2NH_4^+(aq.)+2NO_3^-(aq.)[/tex]
Net ionic equation of any reaction does not include any spectator ions.
Spectator ions are defined as the ions which does not get involved in a chemical equation. They are found on both the sides of the chemical reaction when it is present in ionic form.
As, ammonium and nitrate ions are present on both the sides of the reaction. Thus, it will not be present in the net ionic equation and are spectator ions.
The net ionic equation for the above reaction follows:
[tex]Pb^{2+}(aq.)+2Cl^-(aq.)\rightarrow PbCl_2(s)[/tex]
Solubility rules:
Chlorides of silver, mercury and lead are insoluble in water. So, they appear as a solid known as precipitate.Nitrates of most of the metals are soluble in water. So, they appear as ions in solution.Hence, the correct answer is Option B.
When a compound is dissolved in hot ethanol during a recrystallization, what is changing on a molecular level? The intermolecular forces between the solute and solvent The covalent bonds of the solute The compound slowly melts into the hot solvent The covalent bonds between the solute and solvent
Answer:
The intermolecular forces between the solute and solvent.
Explanation:
When you are heating a solvent, the intermolecular forces are reduced because the distances between molecules are large. Thus, in a solution where solvent is hot the intermolecular forces between solute and solvent are lower than those solutions where solvent is in room temperature.
The covalent bonds do not change because this mean a chemical reaction that doesn't occur in a solution.
Usually solid solutes melts in a higher temperature than boiling point in solvents. Thus, a compound normally doesn't melt in a hot solvent.
I hope it helps!
When a compound is dissolved in hot ethanol during recrystallization, the intermolecular forces between the solute and solvent are changing on a molecular level. The process of solution formation involves the formation of new intermolecular forces between the solute and solvent molecules, allowing the compound to dissolve in the solvent.
Explanation:Intermolecular forces are attractive or repulsive forces between molecules. They include London dispersion forces, dipole-dipole interactions, and hydrogen bonding. These forces influence physical properties like boiling points and solubility in molecular substances. The intermolecular forces between the solute and solvent are changing on a molecular level when a compound is dissolved in hot ethanol during recrystallization.
When the compound is dissolved in the hot solvent, the solute-solvent interactions which is also known as solvatio then naturally takes place. In addition to this, these interactions involve the formation of new intermolecular forces between the solute and solvent molecules, which are nearly as strong as the intermolecular forces within the solute and solvent alone. This favorable solution formation process allows the compound to dissolve in the solvent.
Zinc reacts with hydrochloric acid according to the reaction equation shown. Zn(s) + 2 HCl(aq) → ZnCl2(aq) + H2(g) How many milliliters of 2.50 M HCl(aq) are required to react with 4.65 g of an ore containing 50.0% Zn(s) by mass? volume: mL
Answer:
Volume of HCl required = 28.4 mL
Explanation:
[tex]Zn(s) + 2HCl (aq) \rightarrow ZnCl_2(aq) + H_2(g)[/tex]
Mass of zinc ore = 4.65 g
% of zinc in zinc ore = 50 %
So, mass of zinc in zinc ore = 0.50 × 4.65 = 2.325 g
No. of moles of Zn = [tex]\frac{2.325}{65.40} = 0.0355\ mol[/tex]
So, as per the reaction coefficient,
1 mol of zinc reacts with 2 mol of HCl
0.0355 mol of zinc reacts with
= 0.0355 × 2 = 0.071 mol of HCl
Molarity of HCl = 2.50 M
Volume of HCl = [tex]\frac{Moles}{Concentration}[/tex]
[tex]Volume\ of\ HCl = \frac{0.071}{2.50} = 0.0284\ L[/tex]
1 L = 1000 mL
0.0284 L = 1000 × 0.0284 = 28.4 mL
Write 0.00000009345 in Engineering Notation with 3 significant figures
Answer:
[tex]93.43\times 10^{-9}[/tex]
Explanation:
Scientific notation is the way of writing numbers which are either large or small. The number is written in the scientific notation when the number is between 1 and 10 and then multiplied by the power of 10. Engineering notation is the same version of the scientific notation but the number can be between 1 and 1000 and in this exponent of the ten is divisible by three.
For example, [tex]1000^2[/tex] is to be written as [tex]10^6[/tex] in engineering notation.
The given number:
0.00000009345 can be written as [tex]93.425\times 10^{-9}[/tex]
Answer upto 4 significant digits = [tex]93.43\times 10^{-9}[/tex]
how many grams of solid NaOH are required to prepare a 400ml of a 5N solution? show your work!
Answer: The mass of solid NaOH required is 80 g
Explanation:
Equivalent weight is calculated by dividing the molecular weight by n factor. The equation used is:
[tex]\text{Equivalent weight}=\frac{\text{Molecular weight}}{n}[/tex]
where,
n = acidity for bases = 1 (For NaOH)
Molar mass of NaOH = 40 g/mol
Putting values in above equation, we get:
[tex]\text{Equivalent weight}=\frac{40g/mol}{1eq/mol}=40g/eq[/tex]
Normality is defined as the umber of gram equivalents dissolved per liter of the solution.
Mathematically,
[tex]\text{Normality of solution}=\frac{\text{Number of gram equivalents} \times 1000}{\text{Volume of solution (in mL)}}[/tex]
Or,
[tex]\text{Normality of solution}=\frac{\text{Given mass}\times 1000}{\text{Equivalent mass}\times \text{Volume of solution (in mL)}}[/tex] ......(1)
We are given:
Given mass of NaOH = ?
Equivalent mass of NaOH = 40 g/eq
Volume of solution = 400 mL
Normality of solution = 5 eq/L
Putting values in equation 1, we get:
[tex]5eq/L=\frac{\text{Mass of NaOH}\times 1000}{40g/eq\times 400mL}\\\\\text{Mass of NaOH}=80g[/tex]
Hence, the mass of solid NaOH required is 80 g
An AM radio station broadcasts at 1030 kHz , and its FM partner broadcasts at 98.5 MHz .
partA;Calculate the energy of the photons emitted by the AM radio station.
partB;Calculate the energy of the photons emitted by the FM radio station.
partC;Compare the energy of the photons emitted by the AM radio station with the energy of the photons emitted by the FM radio station.
The energy of the photons emitted by the AM and FM radio stations can be calculated using Planck's equation (E = hf). The calculated energies show that the FM radio station's photons have higher energy than the AM radio station's photons.
Explanation:To calculate the energy of the photons emitted by radio stations, we use the formula:
E = hf, where E is the energy, h is Planck's constant (6.62607015 × 10⁻³⁴ Js) and f is the frequency.
(For the sake of this calculation, we are going to convert the frequency from kHz and MHz to Hz.)
The AM radio station broadcasts at 1030 kHz, which is equal to 1.03×10⁶ Hz. Substitute the values into the formula: E = (6.62607015 × 10⁻³⁴ Js) × (1.03 × 10⁶ Hz) = 6.825 × 10⁻²⁸ joules.The FM radio station broadcasts at 98.5 MHz, which is equal to 98.5×10^6 Hz. Substitute the values into the formula: E = (6.62607015 × 10⁻³⁴ Js) × (98.5 × 10⁶ Hz) = 6.527 × 10⁻²⁶ joules.Comparing these energy values, it's clear that the FM radio station's emitted photons have a higher energy than the AM radio station's photons, due to its higher frequency.
Learn more about Energy of Photons here:https://brainly.com/question/34240307
#SPJ2
When 0.491 grams of a protein were dissolved in 44 mL of benzene at 24.4 degrees C, the osmotic pressure was found to be 50.9 torr. Calculate the molar mass of the protein.
Answer:
4057.85 g/mol
Explanation:
Hello, the numerical procedure is shown in the attached file.
- In this case, since we don't have the density of the protein, we must assume that the volume of the solution is solely given by the benzene's volume, in order to obtain the moles of the solute (protein).
-Van't Hoff factor is assumed to be one.
Best regards.
To calculate the molar mass of the protein, use the formula M = (RT) / (V * P), where M is the molar mass, R is the ideal gas constant, T is the temperature, V is the volume, and P is the osmotic pressure.
Explanation:To calculate the molar mass of the protein, we can use the formula:
M = (RT) / (V * P)
Where M is the molar mass, R is the ideal gas constant (0.0821 L.atm/mol.K), T is the temperature in Kelvin (24.4 + 273 = 297.4 K), V is the volume in liters (44 mL / 1000 = 0.044 L), and P is the osmotic pressure in atm (50.9 torr / 760 = 0.067 atm).
Substituting the values into the formula:
M = (0.0821 * 297.4) / (0.044 * 0.067) = 25567.14 g/mol
Therefore, the molar mass of the protein is approximately 25567.14 g/mol.
What percentage of the mass of a carbon-12 atom is
contributedby its electrons? Given the mass of an electron is
(1/1836)amu.
Answer:
% of mass of electrons in C = 0.0272
Explanation:
Atomic no. of carbon = 6
So, no. of electron = 6
Mass of an electron = [tex]\frac{1}{1836} amu[/tex]
Mass of 6 electrons = [tex]6 \times \frac{1}{1836} = 0.003268 amu[/tex]
Mass of C = 12.0107 u
% of mass of electrons in C = [tex]\frac{Mass\ of\ all\ electrons}{Mass\ of\ C}\times 100[/tex]
% of mass of electrons in C = [tex]\frac{0.003268}{12.0107}\times 100=0.0272 \%[/tex]
A student made an initial 1:5 dilution of protein lysate. Then 2mL of that was added to 8mL of water. Lastly, the student made a 1:20 dilution of the second tube. What is the final dilution of protein lysate.
Answer:
The final dilution is 1:400
Explanation:
Let's analyze what we are told: we have an initial 1:5 dilution of protein lysate. This means that the initial solution (stock solution) was diluted 5 times. Then, from this dilution the student prepared another dilution taking 2 mL of the first dilution in 8 mL of water. This is the same as saying we took 1 mL of first dilution in 4 mL of water (the ratio is the same), so we now have a second 1:4 dilution of the first dilution (1:5). Finally, the student made a third 1:20 dilution, this means that the second dilution was further diluted 20 times.
So, to calculate the final dilution of protein lysate, we have to multiply all the dilution factors of every dilution prepared: in this case we have a final dilution of 1:20, this means we have a factor dilution of 20. But it was previously diluted 4 times, so we have a factor dilution of 20×4 = 80. However, this dilution was also previously diluted 5 times, so the new dilution factor is 80 × 5 = 400
This means that the final dilution of the compound was diluted a total of 400 times compared to the initial concentration of stock solution.
Calculate the vapor pressure (in torr) at 298 K in a solution prepared by dissolving 42.4 g of the non-volatile non-electrolye urea {CO(NH2)2} in 195 g of ethanol. The vapor pressure of ethanol at 298 K is 58.9 torr. Give your answer to 2 decimal places.
Answer:
The vapor pressure at 298 K for this solution is 50,49 Torr.
Explanation:
We have to apply Raoult's law to solve this which its formula is:
P pure sv° - P sl = P pure sv° . X (molar fraction)
ΔP = P pure sv° . X (molar fraction)
58,9 Torr - P sl = 58,9 Torr . X
Molar mass urea CO(NH2)2: 60,06 g/m
Molar mass ethanol: 46,07 g/m
Moles for urea: 42,4 g / 60,06 g/m = 0,705 moles
Moles for ethanol: 195 g / 46,06 g/m = 4,233 moles
X (molar fraction): moles from solute / moles from solute + moles from solvent
X (molar fraction): 0,705 / 0,705 + 4,233 = 0,142
58,9 Torr - P sl = 58.9 Torr . 0,142
58,9 Torr - 8,40 Torr = P sl
50,49 Torr = P sl
A chemist adds 200.0 mL of a 11.0M silver perchlorate (AgCIO solution to a reaction flask. Calculate the millimoles of silver perchlorate the chemist has added to the flask. Be sure your answer has the correct number of significant digits. mmol OP ?
Answer:
[tex]n=2.20x10^{3} mmol[/tex]
Explanation:
Hello,
To compute such moles, one must identify that the concentration unit in this problem is molarity, which is defined by:
[tex]M=\frac{n}{V}[/tex]
Since we are inquired to compute the moles, we solve for them as follows:
[tex]n=M*V=11.0mol/L*200.0*\frac{1L}{1000mL}\\n=2.2mol[/tex]
Finally, this value in millimoles turns out into:
[tex]n=2.2mol*\frac{1000mmol}{1mol}\\n=2.20x10^{3} mmol[/tex]
Best regards.
Define "Dispersed System", "Dispersion Medium", and "Dispersed Particles
Answer:
Dispersion system is a system in which certain particles are scattered in a continuous liquid or solid medium. The two phases present in this system are the dispersed particles and dispersion medium. These phases may or may not be present in the same state.
In a dispersion system, the particles that are dispersed are known as the dispersed particles and the medium in which the particles are dispersed is known as the dispersion medium.
Why was 1,2 dichlorobenzene used as the solvent for the diels alder reaction we performed in the lab?
Because it smells good since it is aromatic
Because it is easy to remove from the product since it is quite volatile
Because it can kill some bacteria in the reactants since it is toxic
because the co elimination part of the reaction needs high temp and a high boiling point solvent such as 1,2 dichlorobenzene bp 179C has to be used
Answer:
1,2 dichlorobenzene was used as the solvent for the diels alder reaction: because the co elimination part of the reaction needs high temp and a high boiling point solvent such as 1,2 dichlorobenzene
Explanation:
Diels-Alder Reaction is a useful synthetic tool to prepare cyclohexane rings. It is a process, which occurs in a single step that consists of a cyclic redistribution of its electrons. The two reagents are bond together through a cyclic transition state in which the two new C-C bonds are formed at the same time. For this to occur, most of the time, it is necessary a high temperature and high-pressure conditions. Since 1,2 dichlorobenzene has a boiling point of 180ºC is a good solvent for this type of reactions.
We know that one mole of Oxygen gas contains two moles of O atoms (remember that O is a diatomic element in nature and is written O2). If we have a sample of O2 that contains 1.0000 x 10-20 mol, we will have (blank)
atoms of O in the sample.
Answer:
12.4 × 10∧3 atoms
Explanation:
Given data:
moles of oxygen molecule= 1.0000 x 10-20 mol
atoms =?
Solution:
32 g O2 = 1 mol = 6.02 × 10∧23
1.0000 x 10∧-20 mol × 6.02 × 10∧23 × 2 = 12.4 × 10∧3 atoms
in which of these substances is significant hydrogen bonding possible: methylene chloride (CH2Cl2), phosphine (PH3), chloramine (NH2Cl), acetone (CH3COCH3) ?
Answer:
Significant hydrogen bonding is possible in [tex]NH_{2}Cl[/tex]
Explanation:
Hydrogen bonding takes place between an electronegative atom (O, N and F) and a H atom attached to those electronegative atoms.Lewis structure reveals that H atom attached to N in [tex]NH_{2}Cl[/tex].In all other compounds no such H atom is present attached to O or N or F.Hence significant hydrogen bonding is possible only in [tex]NH_{2}Cl[/tex]Lewis structures are given below.The only substance from above in which significant hydrogen bonding possible is chloramine ( NH2Cl )
What are organic compounds?Organic compounds are substances which contain carbon and hydrogen. Some few groups of organic compounds include:
AlkanesAlkenesAlkynesAlkanolsAlkanalsAlkanonesKetonesAminesSo therefore, the only substance from above in which significant hydrogen bonding possible is chloramine ( NH2Cl )
Learn more about organic compounds:
https://brainly.com/question/704297