I have a 5 M stock solution of KCI (For a protocol 100 mM KCl is considered "1X" concentration). If I want to make 10 ml of a 4X concentration KCl solution, how much 5 M stock and how much water do I need to add together?

Answer:

% of mass of electrons in C = 0.0272

Explanation:

Atomic no. of carbon = 6

So, no. of electron = 6

Mass of an electron = [tex]\frac{1}{1836} amu[/tex]

Mass of 6 electrons = [tex]6 \times \frac{1}{1836} = 0.003268 amu[/tex]

Mass of C = 12.0107 u

% of mass of electrons in C = [tex]\frac{Mass\ of\ all\ electrons}{Mass\ of\ C}\times 100[/tex]

% of mass of electrons in C = [tex]\frac{0.003268}{12.0107}\times 100=0.0272 \%[/tex]

Answer:

a) m  = 2398256.64 Ib/hr

b) Q = 38433.6 ft^3/hr

c) J = = 898560 lb/h-ft2

Explanation:

a) To get the mass flow rate in lb/h we are going to use this formula:

m = ρνA

note: we have to change some units to reach to the final units

when m is the mass flow rate which we need to calculate

ρ is the density of water in lb/ft3 = 62.4 lbs/ft3 it is a constant numbers you can get it from anywhere

ν is the velocity of the water = 4 ft/s we need to change it to ft/h unit so  

when 1 ft/s = 3600 ft/hr (note : 3600 is a result of converting hr to sec 60min*60sec)

so  the velocity of the water = 4 ft/s * 3600 ft/hr= 14400 ft/hr

now , we need to get the area of the pipe in feet also when:

A = π*diameter * length

diameter = 3.068 inches

when 1 inch = 0.0833333333 feet so,

diameter in feet = 3.068 * 0.0833333333 =.300 0.2557ft

and length = 40 * 0.0833333333  = 3.333 ft

so the area of the pipe in feet^2 = 3.14*0.255*3.33 =2.669 ft^2

by substitution in the mass flow rate:

m = 62.4 lbs/ft3 * 14400 ft/hr *2.669 ft^2 = 2398256.64 Ib/hr

b) now to calculate volumetric flow rate in ft /h  we are going to use this formula:

Q = AV

when Q is  the volume flow rate

A is the cross-sectional area filled by water =2.669 ft^2

V is the average velocity of the water = 14400 ft/hr

so , by substitution:

Q = 2.669  ft^2* 14400 ft/hr= 38433.6 ft^3/hr

C) To calculate mass velocity (mass flux) in lb/h-ft  we are going to use this formula:

J = m / A

when J is the mass flux

and m is the mass flow rate which we calculated above = 2398256.64 Ib/hr

and A is the cross section area of the pipe which we calculated above and = 2.669 ft^2

so, by substitution:

J = 2398256.64 Ib/hr /  2.669 ft^2

 = 898560 lb/h-ft2

Answer:

[tex]5.5*10x^{-9}m[/tex]

Explanation:

As you have the diameter of the sphere in nanometers (nm), you need to use de conversion factor to find the diameter in meters (m):

First you should put the quantity that you want to convert with its respective units:

[tex]Diameter=5.5nm[/tex]

Then you put the conversion factor, always you should put the same unit that you want to convert in the denominator:

Diameter = [tex]5.5nm*\frac{1*10^{-9}m}{1nm}[/tex]

And finally, you should multiply and/or divide the quantities:

Diameter = [tex]5.5*10^{-9}m[/tex]

Answer: The mass of hydrogen gas and nitrogen gas produced is 0.45 g and 3.15 g respectively.

Explanation:

To calculate the number of moles, we use the equation:

[tex]\text{Number of moles}=\frac{\text{Given mass}}{\text{Molar mass}}[/tex]      .....(1)

Given mass of water = 4.05 g

Molar mass of water = 18 g/mol

Putting values in equation 1, we get:

[tex]\text{Moles of water}=\frac{4.05g}{18g/mol}=0.225mol[/tex]

For the given chemical reaction:

[tex]2H_2O\rightarrow 2H_2+O_2[/tex]

By Stoichiometry of the reaction:

2 moles of water is producing 2 moles of hydrogen gas

So, 0.225 moles of water will produce = [tex]\frac{2}{2}\times 0.225=0.225mol[/tex] of hydrogen gas.

Now, calculating the mass of hydrogen gas by using equation 1, we get:

Moles of hydrogen gas = 0.225 mol

Molar mass of hydrogen gas = 2 g/mol

Putting values in equation 1, we get:

[tex]0.225mol=\frac{\text{Mass of hydrogen gas}}{2g/mol}\\\\\text{Mass of hydrogen gas}=0.45g[/tex]

By Stoichiometry of the reaction:

2 moles of water is producing 1 mole of nitrogen gas

So, 0.225 moles of water will produce = [tex]\frac{1}{2}\times 0.225=0.1125mol[/tex] of nitrogen gas.

Now, calculating the mass of nitrogen gas by using equation 1, we get:

Moles of nitrogen gas = 0.1125 mol

Molar mass of nitrogen gas = 28 g/mol

Putting values in equation 1, we get:

[tex]0.1125mol=\frac{\text{Mass of nitrogen gas}}{28g/mol}\\\\\text{Mass of nitrogen gas}=3.15g[/tex]

Hence, the mass of hydrogen gas and nitrogen gas produced is 0.45 g and 3.15 g respectively.

Answer: The correct answer is Option B.

Explanation:

The chemical equation for the reaction of lead (II) nitrate and ammonium chloride follows:

[tex]Pb(NO_3)_2(aq.)+2NH_4Cl(aq.)\rightarrow PbCl_2(s)+2NH_4NO_3(aq.)[/tex]

Ionic form of the above equation follows:

[tex]Pb^{2+}(aq.)+2NO_3^-(aq.)+2NH_4^+(aq.)+Cl^-(aq.)\rightarrow PbCl_2(s)+2NH_4^+(aq.)+2NO_3^-(aq.)[/tex]

Net ionic equation of any reaction does not include any spectator ions.

Spectator ions are defined as the ions which does not get involved in a chemical equation. They are found on both the sides of the chemical reaction when it is present in ionic form.

As, ammonium and nitrate ions are present on both the sides of the reaction. Thus, it will not be present in the net ionic equation and are spectator ions.

The net ionic equation for the above reaction follows:

[tex]Pb^{2+}(aq.)+2Cl^-(aq.)\rightarrow PbCl_2(s)[/tex]

Solubility rules:

Hence, the correct answer is Option B.

Answer:

Significant hydrogen bonding is possible in [tex]NH_{2}Cl[/tex]

Explanation:

The only substance from above in which significant hydrogen bonding possible is chloramine ( NH2Cl )

Organic compounds are substances which contain carbon and hydrogen. Some few groups of organic compounds include:

So therefore, the only substance from above in which significant hydrogen bonding possible is chloramine ( NH2Cl )

Learn more about organic compounds:

https://brainly.com/question/704297

Answer: The mass of air present in the room is 37.068 kg

Explanation :  Given,

Length of the room = 10.0 ft

Breadth of the room = 11.0 ft

Height of the room = 10.0 ft

To calculate the volume of the room by using the formula of volume of cuboid, we use the equation:

[tex]V=lbh[/tex]

where,

V = volume of the room

l = length of the room

b = breadth of the room

h = height of of the room

Putting values in above equation, we get:

[tex]V=10.0ft\times 11.0ft\times 10.0ft=1100ft^3=31148.53L[/tex]

Conversion used : [tex]1ft^3=28.3168L[/tex]

Now we have to calculate the mass of air in the room.

[tex]Density=\frac{Mass}{Volume}[/tex]

[tex]1.19g/L=\frac{Mass}{31148.53L}[/tex]

[tex]Mass=37066.7507g=37.068kg[/tex]

Conversion used : (1 kg = 1000 g)

Therefore, the mass of air present in the room is 37.068 kg

Answer: There are 37 kg of air in the room.

Explanation:

To calculate the volume of cuboid (room), we use the equation:

[tex]V=lbh[/tex]

where,

V = volume of cuboid

l = length of room = 11 ft

b = breadth of room =  10 ft

h = height of room= 10 ft

Putting values in above equation, we get:

[tex]V=10\times 11\times 10=1100ft^3=1100\times 28.3L=31130L[/tex]  (Conversion factor: [tex]1ft^3=28.3L[/tex]

To calculate mass of a substance, we use the equation:

[tex]\text{Density of substance}=\frac{\text{Mass of substance}}{\text{Volume of substance}}[/tex]

We are given:

Density of air = 1.19 g/L

Volume of air = volume of room =  31130 L

Putting values in above equation, we get:

[tex]1.19g/L=\frac{\text{Mass of air}}{31130L}\\\\\text{Mass of air}=37000g=37.0kg[/tex]    (1kg=1000g)

Hence, the mass of air is 37 kg.

Answer:

[tex]93.43\times 10^{-9}[/tex]

Explanation:

Scientific notation is the way of writing numbers which are either large or small. The number is written in the scientific notation when the number is between 1 and 10 and then multiplied by the power of 10. Engineering notation is the same version of the scientific notation but the number can be between 1 and 1000 and in this exponent of the ten is divisible by three.

For example, [tex]1000^2[/tex] is to be written as [tex]10^6[/tex] in engineering notation.

The given number:

0.00000009345 can be written as [tex]93.425\times 10^{-9}[/tex]

Answer upto 4 significant digits = [tex]93.43\times 10^{-9}[/tex]

Answer:

The final dilution is 1:400

Explanation:

Let's analyze what we are told: we have an initial 1:5 dilution of protein lysate. This means that the initial solution (stock solution) was diluted 5 times. Then, from this dilution the student prepared another dilution taking 2 mL of the first dilution in 8 mL of water. This is the same as saying we took 1 mL of first dilution in 4 mL of water (the ratio is the same), so we now have a second 1:4 dilution of the first dilution (1:5). Finally, the student made a third 1:20 dilution, this means that the second dilution was further diluted 20 times.

So, to calculate the final dilution of protein lysate, we have to multiply all the dilution factors of every dilution prepared: in this case we have a final dilution of 1:20, this means we have a factor dilution of 20. But it was previously diluted 4 times, so we have a factor dilution of 20×4 = 80. However, this dilution was also previously diluted 5 times, so the new dilution factor is 80 × 5 = 400

This means that the final dilution of the compound was diluted a total of 400 times compared to the initial concentration of stock solution.

Answer:

The vapor pressure at 298 K for this solution is 50,49 Torr.

Explanation:

We have to apply Raoult's law to solve this which its formula is:

P pure sv° - P sl = P pure sv° . X (molar fraction)

ΔP = P pure sv° . X (molar fraction)

58,9 Torr - P sl = 58,9 Torr . X

Molar mass urea CO(NH2)2: 60,06 g/m

Molar mass ethanol: 46,07 g/m

Moles for urea: 42,4 g /  60,06 g/m = 0,705 moles

Moles for ethanol: 195 g / 46,06 g/m = 4,233 moles

X (molar fraction): moles from solute / moles from solute + moles from solvent

X (molar fraction): 0,705 / 0,705 + 4,233 = 0,142

58,9 Torr - P sl = 58.9 Torr . 0,142

58,9 Torr - 8,40 Torr = P sl

50,49 Torr = P sl

Answer:

The expression to calculate the mass of the reactant is [tex]m = \frac{1.080kJ}{31.2kJ/g}[/tex]

Explanation:

The amount of heat released is equal to the amount of heat released per gram of reactant times the mass of the reactant. To keep to coherence between units we need to transform 1,080 J to kJ. We do so with proportions:

[tex]1,080J.\frac{1kJ}{10^{3}J } =1.080kJ[/tex]

Then,

[tex]1.080kJ=31.2\frac{kJ}{g} .m\\m = \frac{1.080kJ}{31.2kJ/g}[/tex]

Answer:

1. The expression is: [tex]m=\frac{E}{\Delta _rH}[/tex]

2. The computed mass is: [tex]m=0.0346g[/tex]

Explanation:

Hello,

In this case, we know the so called enthalpy of reaction whose symbol and value is shown below:

[tex]\Delta _rH=31.2\frac{kJ}{g}[/tex]

In addition, we know that the energy released by the involved reactant is:

[tex]E=1080 J[/tex]

Therefore, the expression to compute the required mass, based on the given units is:

[tex]m=\frac{E}{\Delta _rH}[/tex]

Finally, the computed mass turns out:

[tex]m=\frac{1080J*\frac{1kJ}{1000J} }{31.2\frac{kJ}{g}} \\m=0.0346g[/tex]

Best regards.

Answer:

It is necessary 1 meter of thickness.

Explanation:

You need to know the equation (P/A)=(k*T)/(L), where P/A is the heat flux, k is the thermal conductivity, T the temperature drop, and L the unknown thickness. So if rearrange the variables you will have that L = (k*T)/(P/A), and substituting the terms L = (0.2*400)/(200) = 1 meter

Final answer:

The necessary thickness of insulation to achieve a temperature drop of 400°C with a heat flux of 200 W/m^2, given a thermal conductivity of 0.2 W/m°C, is 0.4 meters.

Explanation:

The necessary thickness of insulation for a specific temperature drop and heat flux. By using the equation of thermal conduction Q = (kAΔT)/d, where Q is the heat flux, k is the thermal conductivity, A is the area, ΔT is the temperature difference, and d is the thickness, we can solve for the thickness d.

To start, we know that k (thermal conductivity) is 0.2 W/m°C, the temperature drop ΔT is 400°C, and the heat flux Q is 200 W/m^2. Plugging these values into the equation gives us d = (kAΔT)/Q. Since the area A is not specified, it will cancel out in this case, allowing us to solve for d directly. Rearranging the equation yields d = (kΔT)/Q, which equals (0.2 W/m°C * 400°C)/200 W/m^2, resulting in d = 0.4 m. Therefore, the thickness required for this insulation is 0.4 meters.

Answer:

See explanation

Explanation:

Sea water = a mixture of different substances in water. If the water evaporates, some of those substances remain as salts. It's not a compound because it's a mixture of compounds and substances. An example of a compound is water ( because it has hydrogen atoms and an oxygen atom)

Calcium = Calcium is found on the periodic table so it cannot be a compound or mixture. It's a metallic element because we can find it on the left side of the periodic table, in group 2.  It's an alkaline earth metal, what makes that calcium is a reactive metal.

Argon = Argon is found on the periodic table, so it can't be a mixture or compound. It is a non-metallic element. We can find it in group 18 on the periodic table. Argon is a noble gas, so non-metallic.

Water = a compound because its only made of 2 atoms : oxygen and hydrogen.  Reasons why water is a compound and not a mixture are:

 - The ormation of a compound is a chemical change which is followed by absorption of energy or evolution of energy, in case of water, electricity is required.

- Mixtures can be separated by physical separation techniques ,Water can not be separated into it its elements by physical separation techniques. But by the absorption of chemical energy.

Air = Mixture because it can be separated into different atoms, molecules,..  like oxygen, nitrogen etc. by the physical separation techniques (fractional distillation).

Carbon Monoxide = Carbon Monoxide is not found on the periodic table so it cannot be an element. It's made of 2 elements, this means caron monoxide is a compound. It's not a mixture since the elements cannot be separated by physical separating techniques.

Iron = Iron is found on the periodic table so it cannot be a compound or mixture. It's a metallic element because:

-High melting point

-  Some metals form a dull oxide layer, this explains the shiny luster surface

- Electrical conductivity and thermal conductivity

Sodium chloride = NaCl cannot be found on the periodic table, so it isn't an element. It's a compound because it only has 2 atoms (elements). Those elements cannot be seperated by physical separating techniques, but would require electricity. So it's a compound.

Diamond = is a solid form of the element Carbon.  It's an allotrope of carbon. They have the same physical state but in distinct form. Technically diamond is a non-metallic element. Since it's seen as carbon.

Brass = Brass is a mixture of the elements of copper and zinc. Those elements can be separated by physical techniques.

Copper = Copper is found on the periodic table so it cannot be a compound or mixture. It's a metallic element because:

-High melting point

-  Some metals form a dull oxide layer, this explains the shiny luster surface

- Electrical conductivity and thermal conductivity

Dilute sulphuric acid = This is a mixture. Sulphuric acid is a compound but to dilute it's added in water, what is another compound. So it's a mixture of different compounds.

Sulphur = Can be found in the periodic table so it cannot be a mixture or compound. It's part of the metalloids, therefore, it can be concluded that sulfur is a non-metal. It belongs to the oxygen family.

Oil = Oil is a mixture of hydrocarbon compounds which varies in lengths.

Nitrogen = Nitrogen is found on the periodic table, so it can't be a mixture or compound. It can be found as a gas so it is a non-metallic element.

Ammonia = a compound of nitrogen and hydrogen with the formula NH3. Those elements cannot be separated with physical separating techniques.

Answer:

NCL3

Explanation:

NCL3

- nitrogen trichloride.

The chemical formula for a compound containing one nitrogen atom for every three chlorine atoms is NCl₃.

The chemical formula NCl₃ represents a compound consisting of one nitrogen atom and three chlorine atoms. In this formula, "N" represents nitrogen, and "Cl" represents chlorine. The subscript "3" indicates that there are three chlorine atoms bonded to each nitrogen atom in the compound.

This arrangement reflects the stoichiometry of the compound, specifying the relative ratios of the elements. Chemical formulas provide a concise way to describe the composition of substances, allowing scientists to understand the types and quantities of atoms present in a compound.

NCl₃, nitrogen trichloride, is a covalent compound with notable chemical properties, and its formula encapsulates the balanced proportion of nitrogen and chlorine within its molecular structure.

To know more about nitrogen atom here

https://brainly.com/question/2396742

#SPJ3

Answer:

1,2 dichlorobenzene was used as the solvent for the diels alder reaction: because the co elimination part of the reaction needs high temp and a high boiling point solvent such as 1,2 dichlorobenzene

Explanation:

Diels-Alder Reaction is a useful synthetic tool to prepare cyclohexane rings. It is a process, which occurs in a single step that consists of a cyclic redistribution of its electrons. The two reagents are bond together through a cyclic transition state in which the two new C-C bonds are formed at the same time. For this to occur, most of the time, it is necessary a high temperature and high-pressure conditions. Since 1,2 dichlorobenzene has a boiling point of 180ºC is a good solvent for this type of reactions.

Answer:

The intermolecular forces between the solute and solvent.

Explanation:

When you are heating a solvent, the intermolecular forces are reduced because the distances between molecules are large. Thus, in a solution where solvent is hot the intermolecular forces between solute and solvent are lower than those solutions where solvent is in room temperature.

The covalent bonds do not change because this mean a chemical reaction that doesn't occur in a solution.

Usually solid solutes melts in a higher temperature than boiling point in solvents. Thus, a compound normally doesn't melt in a hot solvent.

I hope it helps!

When a compound is dissolved in hot ethanol during recrystallization, the intermolecular forces between the solute and solvent are changing on a molecular level. The process of solution formation involves the formation of new intermolecular forces between the solute and solvent molecules, allowing the compound to dissolve in the solvent.

Intermolecular forces are attractive or repulsive forces between molecules. They include London dispersion forces, dipole-dipole interactions, and hydrogen bonding. These forces influence physical properties like boiling points and solubility in molecular substances. The intermolecular forces between the solute and solvent are changing on a molecular level when a compound is dissolved in hot ethanol during recrystallization.

When the compound is dissolved in the hot solvent, the solute-solvent interactions which is also known as solvatio then naturally takes place. In addition to this, these interactions involve the formation of new intermolecular forces between the solute and solvent molecules, which are nearly as strong as the intermolecular forces within the solute and solvent alone. This favorable solution formation process allows the compound to dissolve in the solvent.

Answer : The rate law is 4.232 mol/L.s

Explanation :

First we have to calculate the value of rate constant.

According to the question, the expression for rate law will be:

[tex]Rate=k[A]^2[B][/tex]

where,

k = rate constant

As we are given :

Rate law = 0.23 mol/L.s

Initial concentration of A = 1.0 mol/L

Initial concentration of B = 1.0 mol/L

Now put all the given values in the above rate law expression, we get:

[tex]0.23mol/L.s=k\times (1.0mol/L)^2\times (1.0mol/L)[/tex]

[tex]k=0.23M^{-2}s^{-1}[/tex]

Now we have to calculate the rate law when initial concentration of A and B is 2.0 mol/L and 4.6 mol//L respectively.

The expression for rate law will be:

[tex]Rate=k[A]^2[B][/tex]

where,

k = rate constant = [tex]0.23M^{-2}s^{-1}[/tex]

Rate law = ?

Initial concentration of A = 2.0 mol/L

Initial concentration of B = 4.6 mol/L

Now put all the given values in the above rate law expression, we get:

[tex]Rate=(0.23M^{-2}s^{-1})\times (2.0mol/L)^2\times (4.6mol/L)[/tex]

[tex]Rate=4.232mol/L.s[/tex]

Therefore, the rate law is 4.232 mol/L.s

The study of chemicals and bonds is called chemistry. When the amount of reactant and product are equal then is said to be an equilibrium state.

The correct answer is 4.232.

According to the question, the expression for rate law will be:

[tex]Rate =k[A]^2[B][/tex]

where,

The data is given as follows:-

Place all the values in the equation and solve it

[tex]0.23= k*1^2*1\\\\k= 0.23[/tex]

Now we have to calculate the rate law when the initial concentration of A and B is 2.0 mol/L and 4.6 mol//L respectively.

The expression for rate law will be:

[tex]Rate =k[A]^2[B][/tex]

where,

[tex]Rate = 0.23*2^2*4.6[/tex]

Hence, the rate will be 4.232.

For more information about the rate of the equation, refer to the link:-

https://brainly.com/question/16759172

Answer:

[tex]n=2.20x10^{3} mmol[/tex]

Explanation:

Hello,

To compute such moles, one must identify that the concentration unit in this problem is molarity, which is defined by:

[tex]M=\frac{n}{V}[/tex]

Since we are inquired to compute the moles, we solve for them as follows:

[tex]n=M*V=11.0mol/L*200.0*\frac{1L}{1000mL}\\n=2.2mol[/tex]

Finally, this value in millimoles turns out into:

[tex]n=2.2mol*\frac{1000mmol}{1mol}\\n=2.20x10^{3} mmol[/tex]

Best regards.

Answer: The mass of solid NaOH required is 80 g

Explanation:

Equivalent weight is calculated by dividing the molecular weight by n factor. The equation used is:

[tex]\text{Equivalent weight}=\frac{\text{Molecular weight}}{n}[/tex]

where,

n = acidity for bases = 1 (For NaOH)

Molar mass of NaOH = 40 g/mol

Putting values in above equation, we get:

[tex]\text{Equivalent weight}=\frac{40g/mol}{1eq/mol}=40g/eq[/tex]

Normality is defined as the umber of gram equivalents dissolved per liter of the solution.

Mathematically,

[tex]\text{Normality of solution}=\frac{\text{Number of gram equivalents} \times 1000}{\text{Volume of solution (in mL)}}[/tex]

Or,

[tex]\text{Normality of solution}=\frac{\text{Given mass}\times 1000}{\text{Equivalent mass}\times \text{Volume of solution (in mL)}}[/tex]         ......(1)

We are given:

Given mass of NaOH = ?

Equivalent mass of NaOH = 40 g/eq

Volume of solution = 400 mL

Normality of solution = 5 eq/L

Putting values in equation 1, we get:

[tex]5eq/L=\frac{\text{Mass of NaOH}\times 1000}{40g/eq\times 400mL}\\\\\text{Mass of NaOH}=80g[/tex]

Hence, the mass of solid NaOH required is 80 g

Answer:

There are 0.1125 g of O₂ less in 1 L of air at 14,000 ft than in 1 L of air at sea level.

Explanation:

To solve this problem we use the ideal gas law:

PV=nRT

Where P is pressure (in atm), V is volume (in L), n is the number of moles, T is temperature (in K), and R is a constant (0.082 atm·L·mol⁻¹·K⁻¹)

Now we calculate the number of moles of air in 1 L at sea level (this means with P=1atm):

1 atm * 1 L = n₁ * 0.082 atm·L·mol⁻¹·K⁻¹ * 298 K

n₁=0.04092 moles

Now we calculate n₂, the number of moles of air in L at an 14,000 ft elevation, this means with P = 0.59 atm:

0.59 atm * 1 L = n₂ * 0.082 atm·L·mol⁻¹·K⁻¹ * 298 K

n₂=0.02414 moles

In order to calculate the difference in O₂, we substract n₂ from n₁:

0.04092 mol - 0.02414 mol = 0.01678 mol

Keep in mind that these 0.01678 moles are of air, which means that we have to look up in literature the content of O₂ in air (20.95%), and then use the molecular weight to calculate the grams of O₂ in 20.95% of 0.01678 moles:

[tex]0.01678mol*\frac{20.95}{100} *32\frac{g}{mol} =0.1125 gO_{2}[/tex]

Answer:

4057.85 g/mol

Explanation:

Hello, the numerical procedure is shown in the attached file.

- In this case, since we don't have the density of the protein, we must assume that the volume of the solution is solely given by the benzene's volume, in order to obtain the moles of the solute (protein).

-Van't Hoff factor is assumed to be one.

Best regards.

To calculate the molar mass of the protein, use the formula M = (RT) / (V * P), where M is the molar mass, R is the ideal gas constant, T is the temperature, V is the volume, and P is the osmotic pressure.

To calculate the molar mass of the protein, we can use the formula:

M = (RT) / (V * P)

Where M is the molar mass, R is the ideal gas constant (0.0821 L.atm/mol.K), T is the temperature in Kelvin (24.4 + 273 = 297.4 K), V is the volume in liters (44 mL / 1000 = 0.044 L), and P is the osmotic pressure in atm (50.9 torr / 760 = 0.067 atm).

Substituting the values into the formula:

M = (0.0821 * 297.4) / (0.044 * 0.067) = 25567.14 g/mol

Therefore, the molar mass of the protein is approximately 25567.14 g/mol.

Answer:

pH of acetic acid solution is 2.88

Explanation:

[tex]pK_{a}=4.75[/tex]

or, [tex]-log(K_{a})=4.75[/tex]

or, [tex]K_{a}=10^{-4.75}=1.78\times 10^{-5}[/tex]

We have to construct an ICE table to determine concentration of [tex]H^{+}[/tex] and corresponding pH. Initial concentration of acetic acid is 0.1 M.

[tex]CH_{3}COOH\rightleftharpoons CH_{3}COO^{-}+H^{+}[/tex]

I(M):  0.1                            0                    0

C(M): -x                              +x                 +x

E(M): 0.1-x                         x                    x

So, [tex]\frac{[CH_{3}COO^{-}][H^{+}]}{[CH_{3}COOH]}=K_{a}[/tex]

or, [tex]\frac{x^{2}}{0.1-x}=1.78\times 10^{-5}[/tex]

or, [tex]x^{2}+(1.78\times 10^{-5}\times x)-(1.78\times 10^{-6})=0[/tex]

So, [tex]x=\frac{-(1.78\times 10^{-5})+\sqrt{(1.78\times 10^{-5})^{2}+(4\times 1\times 1.78\times 10^{-6})}}{2\times 1}[/tex](M)

so, [tex]x=1.33\times 10^{-3}M[/tex]

Hence [tex]pH=-log[H^{+}]=-log(1.33\times 10^{-3})=2.88[/tex]

Answer:

a. 0.14042

b. 0.221

c. equal to a.

5) 0.579 L

3) 8.1e6 ms

Explanation:

Hello,

In the attached photo you'll find the numerical procedure to get the results.

Best regards.

Answer: The mass of air is 0.00260 lbs.

Explanation:

To calculate the number of moles, we use the equation given by ideal gas equation:

PV = nRT

Or,

[tex]PV=\frac{m}{M}RT[/tex]

where,

P = pressure of the gas = 150 psia = 10.2 atm   (Conversion factor:  1 psia = 0.068 atm)

V = Volume of gas = [tex]10in^3=0.164L[/tex]    (Conversion factor:  [tex]1in^3=0.0164L[/tex] )

m = mass of air = ?

M = Average molar mass of air = 28.97 g/mol

R = Gas constant = [tex]0.0820\text{ L atm }mol^{-1}K^{-1}[/tex]

T = temperature of the gas = [tex]440^oF=499.817K[/tex]  (Conversion factor: [tex](T(K)-273.15)=(T(^oF)-32)\times \frac{5}{9}[/tex]  )

Putting values in above equation, we get:

[tex]10.2atm\times 0.164L=\frac{m}{28.97g/mol}\times 0.0820\text{ L atm }mol^{-1}K^{-1}\times 499.817K\\\\m=1.18g[/tex]

Converting this mass into lbs, we use the conversion factor:

1 lbs = 454 g

So, [tex]1.18g\times \frac{1lbs}{454g}=0.00260lbs[/tex]

Hence, the mass of air is 0.00260 lbs.

Explanation:

Orifice meters require to compensate for pressure and temperature when one uses these meters to measure the steam or the gas flow in the pipes with the variable operating pressure as well as temperature conditions.

Normally chemists do not have online density measurement tool and thus to avoid complications, the chemists consider density as constant parameter.

In the steam or the gas flow measurement, density of steam or gas changes as the pressure and the temperature change. This significant  change in the density can affect accuracy of measured flow rate if the change is uncompensated and thus, this has to be fixed in order to avoid errors. Therefore, it is important to compensate for the pressure and the temperature when orifice is used to measure the steam or the gas flow.

Answer:

Dispersion system is a system in which certain particles are scattered in a continuous liquid or solid medium. The two phases present in this system are the dispersed particles and dispersion medium. These phases may or may not be present in the same state.

In a dispersion system, the particles that are dispersed are known as the dispersed particles and the medium in which the particles are dispersed is known as the dispersion medium.

Answer:

Volume of HCl required = 28.4 mL

Explanation:

[tex]Zn(s) + 2HCl (aq) \rightarrow ZnCl_2(aq) + H_2(g)[/tex]

Mass of zinc ore = 4.65 g

% of zinc in zinc ore = 50 %

So, mass of zinc in zinc ore = 0.50 × 4.65 = 2.325 g

No. of moles of Zn = [tex]\frac{2.325}{65.40} = 0.0355\ mol[/tex]

So, as per the reaction coefficient,

1 mol of zinc reacts with 2 mol of HCl

0.0355 mol of zinc reacts with

                                    = 0.0355 × 2 = 0.071 mol of HCl

Molarity of HCl = 2.50 M

Volume of HCl = [tex]\frac{Moles}{Concentration}[/tex]

[tex]Volume\ of\ HCl = \frac{0.071}{2.50} = 0.0284\ L[/tex]

1 L = 1000 mL

0.0284 L = 1000 × 0.0284 = 28.4 mL

The energy of the photons emitted by the AM and FM radio stations can be calculated using Planck's equation (E = hf). The calculated energies show that the FM radio station's photons have higher energy than the AM radio station's photons.

To calculate the energy of the photons emitted by radio stations, we use the formula:

E = hf, where E is the energy, h is Planck's constant (6.62607015 × 10⁻³⁴ Js) and f is the frequency.

(For the sake of this calculation, we are going to convert the frequency from kHz and MHz to Hz.)

Comparing these energy values, it's clear that the FM radio station's emitted photons have a higher energy than the AM radio station's photons, due to its higher frequency.

https://brainly.com/question/34240307

#SPJ2

Answer:

12.4 × 10∧3 atoms

Explanation:

Given data:

moles of oxygen molecule= 1.0000 x 10-20 mol

atoms =?

Solution:

32 g O2 = 1 mol = 6.02 × 10∧23

1.0000 x 10∧-20 mol × 6.02 × 10∧23 × 2 = 12.4 × 10∧3 atoms

Answer:

ghdtgfgrdvreeeegrwwggegteefewqrwefrwerrftrtdsfgyuytfgererdf

Explanation:

The given data is as follows.

     [tex]V_{1}[/tex] = 1.50 L,    [tex]T_{1}[/tex] = 159 K,

      [tex]P_{1}[/tex] = 5.00 atm,   [tex]V_{2}[/tex] = 0.2 L,

       [tex]T_{2}[/tex] = ?,       [tex]P_{2}[/tex] = 50.0 atm  

And, according to ideal gas equation,  

               [tex]\frac{P_{1}V_{1}}{T_{1}} = \frac{P_{2}V_{2}}{T_{2}}[/tex]

Hence, putting the given values into the above formula to calculate the value of final temperature as follows.          

 [tex]\frac{5.0 atm \times 1.50 L}{159 K} = \frac{5 atm \times 0.2 L}{T_{2}}[/tex]

            [tex]T_{2}[/tex] = 21.27 K

Thus, we can conclude that the final temperature is 21.27 K .